PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013584153.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 329aa    MW: 37187.8 Da    PI: 6.2694
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013584153.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.3e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ + + +G g W+t +++ g++R++k+c++rw +yl
   XP_013584153.1 15 KGAWTPEEDQKLISYLNNHGEGGWRTLPEKAGLKRCGKSCRLRWANYL 62
                     79********************************************97 PP

2Myb_DNA-binding52.41.3e-1668112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T++E++ ++ +++++G++ W+ Iar ++ gRt++++k++w+++
   XP_013584153.1  68 RGEFTEDEELSIISLHALHGNK-WSDIARGLP-GRTDNEIKNYWNTH 112
                      899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.8171062IPR017930Myb domain
SuperFamilySSF466894.3E-2812109IPR009057Homeodomain-like
SMARTSM007171.8E-121464IPR001005SANT/Myb domain
PfamPF002491.6E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-231669IPR009057Homeodomain-like
CDDcd001673.32E-91762No hitNo description
PROSITE profilePS5129425.36863117IPR017930Myb domain
SMARTSM007171.7E-1567115IPR001005SANT/Myb domain
PfamPF002493.1E-1568112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2570118IPR009057Homeodomain-like
CDDcd001673.42E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MVRTPCCKPE LGLKKGAWTP EEDQKLISYL NNHGEGGWRT LPEKAGLKRC GKSCRLRWAN  60
YLRPDIKRGE FTEDEELSII SLHALHGNKW SDIARGLPGR TDNEIKNYWN THIKKRLIKK  120
GVDPVTHKSL ISETSKSENL PEILNNQNII QRTISSNDDL GNNEKVKNED KKSRLSSARF  180
LNKVANRVGK KINQSVLSEI IGSGGPLTTT TSVTVDSISD KSMNFSFTPT SYPLNQMTVN  240
DNGNATSPPS MFSDSSVNDP LMYRSVDNIG FPGFLNEQHV MMLEESCVEN TKFMNELTRF  300
LQEDVNNDVE VTPVYEYQDD FEEIGNYFA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5842980.0FJ584298.1 Brassica rapa subsp. pekinensis MYB domain protein 51-3 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013584153.10.0PREDICTED: transcription factor MYB51 isoform X1
SwissprotO497821e-147MYB51_ARATH; Transcription factor MYB51
TrEMBLA0A0D3CB950.0A0A0D3CB95_BRAOL; Uncharacterized protein
STRINGBra025666.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18570.11e-138myb domain protein 51